PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033737
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 361aa    MW: 41505.7 Da    PI: 5.0746
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033737genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++l  +v+++G  +W+  ++  g+ R++k+c++rw +yl
      Lus10033737 14 KGAWSKEEDDKLRSYVTRHGHWNWRELPKFAGLDRCGKSCRLRWMNYL 61
                     79******************99************************97 PP

2Myb_DNA-binding54.13.6e-1768111247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g++++eEdel+v+++++lG++ W++Ia++m  gRt++++k++w+ +
      Lus10033737  68 GNFSAEEDELIVKLFEELGTK-WSAIASKMS-GRTDNEIKNYWHAH 111
                      89*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.131961IPR017930Myb domain
SuperFamilySSF466896.6E-2911108IPR009057Homeodomain-like
SMARTSM007176.9E-111363IPR001005SANT/Myb domain
PfamPF002491.0E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-231568IPR009057Homeodomain-like
CDDcd001678.56E-91661No hitNo description
PROSITE profilePS5129424.72162116IPR017930Myb domain
SMARTSM007171.8E-1566114IPR001005SANT/Myb domain
PfamPF002497.9E-1568111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2469115IPR009057Homeodomain-like
CDDcd001678.06E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MVRAAFYDEK GVRKGAWSKE EDDKLRSYVT RHGHWNWREL PKFAGLDRCG KSCRLRWMNY  60
LRPDLKHGNF SAEEDELIVK LFEELGTKWS AIASKMSGRT DNEIKNYWHA HLKKRAARWT  120
SSKIHNVTES PSTSSSSSSH HLQHPDVENN HDHNSRTEEM DMDMAHHHPP VETTLPPSIL  180
ESSPVSPQQY PLCESFNYPS TSSNLKHVND VVSDEFKMEP RWDSAHNWYE TTVPPPIPES  240
SPFSPEHSLY KSFNHLSTSF DKDDLNHANL IINDGFEMEP YDSHNWCETV QREQVSNDAN  300
YSISGGDFWT EPFVVMDDGG GDMSYKSWGC VGDETTTLMF DDDLESLMYS VMRELPDTSF  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-20141157107B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012087685.11e-63PREDICTED: myb-related protein Myb4-like
STRINGPOPTR_0019s14130.12e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-49myb domain protein 9